PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400020853
Common NameLOC102592168
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 259aa    MW: 29455.5 Da    PI: 7.5928
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400020853genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.24.7e-18173207135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  PGSC0003DMP400020853 173 CTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRL 207
                           *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169927.5E-833256IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.438167203IPR000679Zinc finger, GATA-type
SMARTSM004011.6E-15167217IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.81E-14170231No hitNo description
Gene3DG3DSA:3.30.50.109.2E-14171205IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.76E-13172219No hitNo description
PfamPF003206.8E-16173207IPR000679Zinc finger, GATA-type
PROSITE patternPS003440173198IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MDVYGRLTPE VFRIDDLLDF SNEEIFSSSK TAIDFDLNHH YQPPPTDNIA AAGCYYDALP  60
NSVDFTDKLC VPSDDVAELE WLSNFVEDTS NNFPSNSLTQ TMYHLNNTNN TTTILHSKSR  120
SKRSRNSNTS WTTSSLQQHK STNQKNYNQD ENSGIYNRDK FSSITSNITP RKCTHCASEK  180
TPQWRTGPLG PKTLCNACGV RYKSGRLVPE YRPAASPTFV LTQHSNSHRK VMELRRQKEV  240
IDHQQQQHGM YGHHYPVC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006359592.10.0PREDICTED: GATA transcription factor 4-like
SwissprotO497415e-71GATA2_ARATH; GATA transcription factor 2
TrEMBLM1AUN50.0M1AUN5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000307080.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57761935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.12e-63GATA transcription factor 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]